PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0001s1930.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 329aa    MW: 34864.9 Da    PI: 8.8346
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0001s1930.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.3e-3873132362
                  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             e+alkcprC+s+ntkfCy+nnysl+qPr+fCk+CrryWt+GGalr vPvGgg+r+nk+s+
  SapurV1A.0001s1930.2.p  73 EAALKCPRCESSNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRSK 132
                             6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3456125IPR003851Zinc finger, Dof-type
PfamPF027014.1E-3275130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18976130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MDFSSIPAYL DPANWQQQPN HQTGVSSSTG TQLLPPPPPP PPPPQPHGIG GAGSIRPGSM  60
ADRARLANIP LPEAALKCPR CESSNTKFCY FNNYSLTQPR HFCKTCRRYW TRGGALRSVP  120
VGGGCRRNKR SKESSSKSPI SGYRQTASCS SSTVSSNSGT SDTFGLGPQV PPMRFMAPLH  180
HHTEFASANI GLNYGALSKN LVGGASDMNF QMGSALASSG LGGIGGAGGS LLSMGGFDQW  240
RLQQGQQLPF FGGLDSSASG LYPFEGGAEP SGYGGGADHI RPKISSSTDT PSASVKMEDN  300
QELNMSRQFL GIPGNDQYPE WYFMDRSF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011019882.10.0PREDICTED: dof zinc finger protein DOF2.4
TrEMBLB9HBK60.0B9HBK6_POPTR; Dof zinc finger protein DOF2.4
STRINGPOPTR_0006s08440.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.16e-48DNA binding with one finger 2.4